Search results for 1 DNA Binding Properties of Human Pol B Jos A. Carrodeguas ...

Explore all categories to find your favorite topic

Probing the Binding Site in the Antibiotic Resistance Enzyme, AmpC β-lactamaseHonors Projects Undergraduate Research and Creative Practice 2013 Probing the Binding

Specific β-Turns Precede PPIIL Structures Binding to Allele-Specific HLA-DRβ1* PBRs in Fully-Protective Malaria Vaccine Componentsdoi: 10.3389/fchem.2018.00106

The relationship between abnormal Core binding factor-β expression in human cartilage and osteoarthritisRESEARCH ARTICLE Open Access The relationship between abnormal

Latent TGF-beta Binding Proteins : Adhesive functions and matrix association of LTBP-2 and potential functions of LTBP-1 and LTBP-3 in mesotheliomaLatent TGF-β Binding

Quantifying the DNA Binding Properties of the Binuclear Ruthenium Complex ÎÎ-P12-22-2016 Quantifying the DNA Binding Properties of the Binuclear Ruthenium Complex

Fluorescence Quenching Studies of γ‑Butyrolactone Binding Protein CprB from Streptomyces coelicolor A32 Anwesha Biswas† Ravi K Swarnkar† Bhukya Hussain†‡ Suraj…

Stability of the human polymerase δ holoenzyme and its implications in lagging strand DNA synthesis Mark Hedglina Binod Pandeya and Stephen J Benkovica1 aDepartment of Chemistry…

Journal of Neurochemistry Lippincott—Raven Publishers, Philadelphia © 1998 International Society for Neurochemistry /3-Amyloid Peptides Increase the Binding and Internalization…

ΕΦΗΜΕΡΙΣ ΤΗΣ ΚΥΒΕΡΝΗΣΕΩΣ ΤΗΣ ΕΛΛΗΝΙΚΗΣ ΔΗΜΟΚΡΑΤΙΑΣ ΤΕΥΧΟΣ ΔΕΥΤΕΡΟ Αρ. Φύλλου 1657 26 Ιουλίου 2011…

EGFR binding + D-K6L9 lytic peptide EGFR binding + Newly designed lytic peptide YHWYGYTPQNVIGGGLKLLKKLLKKLLKLL-NH2 YHWYGYTPQNVIGGG KLLLKLLKKLLKLLKKK A B [θ] (deg cm2 dmol-1)…

bi6b01113 1..11Mechanistic Basis for the Binding of RGD- and AGDV-Peptides to the Platelet Integrin αIIbβ3 Olga Kononova,†,§,# Rustem I. Litvinov,‡,⊥

ONCOLOGY LETTERS 15: 747-754, 2018 Abstract. UL16 binding protein 1 (ULBP1) expressed on the tumor cell surface binds to the natural killer group 2 member D (NKG2D) receptor

1 A new phosphatidylinositol 4,5-bisphosphate binding site located in the C2 domain of protein kinase Cαααα. Senena Corbalan-Garcia, Josefa Garcia-Garcia, Jose A. Rodríguez-Alfaro…

1 Probing the β2 adrenoceptor binding site with catechol reveals differences in binding and activation by agonists and partial agonists Gayathri Swaminath, Xavier Deupi,…

research 1..11Mobility and Core-Protein Binding Patterns of Disordered CTerminal Tails in βTubulin Isotypes Yoann Laurin,† Joel Eyer,‡ Charles H. Robert,†

Supporting information A study on the effect of synthetic α-to-β3-amino acid mutations on the binding of phosphopeptides to 14-3-3 proteins Sebastian A. Andrei,

molecules Article Influence of Cysteine and Tryptophan Substitution on DNA-Binding Activity on Maize α-Hairpinin Antimicrobial Peptide Daniel A. Sousa 1,2, William F. Porto…

Biophysical Chemistry 211 2016 19–27 Contents lists available at ScienceDirect Biophysical Chemistry j ourna l homepage: ht tp : wwwe lsev ie r com locate b iophyschem…

Ray S Furuya U Tokushima Japan Polarization imaging: lessons learned and wishes for future instrumentation Introduction Analyzing POL-2 data POL-2 850 micron maps POL-2 sensitivity…

1 What can be learnt from MD Gold binding protein Micelle Light harvesting complex Reaction Center Restriction enzyme Ubiquitin avidin-biotin Gold Binding Protein: 1. Structure…