γλώσσες
Σελίδες
Νομικός
Explore all categories to find your favorite topic
Rhodium(I) Oxygen Adduct as a Selective Catalyst for One-Pot Sequential Alkyne Dimerization-HydrothiolationTandem Reactions George Kleinhans, a Gregorio Guisado-Barrios,
ΒΙΟΓΡΑΦΙΚΟ ΣΗΜΕΙΩΜΑ 1 Δρ Αλέξιος Ν Πολύδωρος Επίκουρος Καθηγητής ΠΡΟΣΩΠΙΚΑ ΣΤΟΙΧΕΙΑ Όνομα: Αλέξιος…
Molecule Oxygen Induced Ferromagnetism and Half-metallicity in α- BaNaO4: A First Principles Study Jun Deng† ‡ Jiangang Guo†§* Xiaolong Chen† ‡§* †Beijing…
Oxygen Nitrogen Hydrogen φ6mm nylon tube, 5mφ3mm SS tube, 3m Power cable (grounded), 5m He (cylinder) 2-stage pressure regulator with approx. 0-0.5 MPa range and connection…
Oxygen, Hydrogen and Carbon Isotopes Fresh water - Rain, Lakes, Groundwater, Ice Plants – Leaves and roots (also specific compounds) Animals – bones and tissue Seawater…
Formation of Reactive Oxygen Species Ground-state oxygen (3O2 ) Oxygen is the most important factor on the development of lipid peroxidation. Ground state oxygen is itself…
EGFR binding + D-K6L9 lytic peptide EGFR binding + Newly designed lytic peptide YHWYGYTPQNVIGGGLKLLKKLLKKLLKLL-NH2 YHWYGYTPQNVIGGG KLLLKLLKKLLKLLKKK A B [θ] (deg cm2 dmol-1)…
bi6b01113 1..11Mechanistic Basis for the Binding of RGD- and AGDV-Peptides to the Platelet Integrin αIIbβ3 Olga Kononova,†,§,# Rustem I. Litvinov,‡,⊥
ONCOLOGY LETTERS 15: 747-754, 2018 Abstract. UL16 binding protein 1 (ULBP1) expressed on the tumor cell surface binds to the natural killer group 2 member D (NKG2D) receptor
1 A new phosphatidylinositol 4,5-bisphosphate binding site located in the C2 domain of protein kinase Cαααα. Senena Corbalan-Garcia, Josefa Garcia-Garcia, Jose A. Rodríguez-Alfaro…
1 Probing the β2 adrenoceptor binding site with catechol reveals differences in binding and activation by agonists and partial agonists Gayathri Swaminath, Xavier Deupi,…
research 1..11Mobility and Core-Protein Binding Patterns of Disordered CTerminal Tails in βTubulin Isotypes Yoann Laurin,† Joel Eyer,‡ Charles H. Robert,†
Supporting information A study on the effect of synthetic α-to-β3-amino acid mutations on the binding of phosphopeptides to 14-3-3 proteins Sebastian A. Andrei,
molecules Article Influence of Cysteine and Tryptophan Substitution on DNA-Binding Activity on Maize α-Hairpinin Antimicrobial Peptide Daniel A. Sousa 1,2, William F. Porto…
Biophysical Chemistry 211 2016 19–27 Contents lists available at ScienceDirect Biophysical Chemistry j ourna l homepage: ht tp : wwwe lsev ie r com locate b iophyschem…
10.1 Oxygen in Organic Photochemistry a common statement: The reaction is quenched by oxygen, thus, it must be a triplet reaction true or false? 10.2 Electronic structure…
Oxygen-sensitive mitochondrial accumulation of cystathionine β-synthase mediated by Lon protease Huajian Tenga,1, Bo Wua,b,1, Kexin Zhaoc, Guangdong Yangc, Lingyun Wud,e,…
Original Article Effect of Laurus nobilis L Essential Oil and its Main Components on α-glucosidase and Reactive Oxygen Species Scavenging Activity Serap Sahin Basak* and…
DIAGNOSIS OF THE THALASSAEMIA SYNDROMES: MEASUREMENT OF HAEMOGLOBIN A2 Barbara Wild UK National External Quality Assessment Scheme London Globin biosynthesis 3 6 3 6 Birth…
DIAGNOSIS OF THE THALASSAEMIA SYNDROMES: MEASUREMENT OF HAEMOGLOBIN A2 Barbara Wild UK National External Quality Assessment Scheme London Globin biosynthesis 3 6 3 6 Birth…