ORIGINAL PAPER
A hydrolytic c-glutamyl transpeptidase from thermo-acidophilicarchaeon Picrophilus torridus: binding pocket mutagenesisand transpeptidation
Rinky Rajput • Ved Vrat Verma • Vishal Chaudhary •
Rani Gupta
Received: 16 July 2012 / Accepted: 9 October 2012 / Published online: 27 October 2012
� Springer Japan 2012
Abstract c-Glutamyl transpeptidase of a thermo-acido-
philic archaeon Picrophilus torridus was cloned and
expressed using E. coli Rosetta-pET 51b(?) expression
system. The enzyme was expressed at 37 �C/200 rpm with
c-GT production of 1.99 U/mg protein after 3 h of IPTG
induction. It was improved nearby 10-fold corresponding
to 18.92 U/mg protein in the presence of 2 % hexadecane.
The enzyme was purified by Ni2?-NTA with a purification
fold of 3.6 and recovery of 61 %. It was synthesized as a
precursor heterodimeric protein of 47 kDa with two sub-
units of 30 kDa and 17 kDa, respectively, as revealed by
SDS-PAGE and western blot. The enzyme possesses
hydrolase activity with optima at pH 7.0 and 55 �C. It was
thermostable with a t1/2 of 1 h at 50 �C and 30 min at
60 �C, and retained 100 % activity at 45 �C even after
24 h. It was inhibited by azaserine and DON and PMSF.
Ptc-GT shared 37 % sequence identity and 53 % homology
with an extremophile c-GT from Thermoplasma acido-
philum. Functional residues identified by in silico approa-
ches were further validated by site-directed mutagenesis
where Tyr327 mutated by Asn327 introduced significant
transpeptidase activity.
Keywords Picrophilus torridus � Thermo-acidophile �c-Glutamyl transpeptidase � Expression � PET 51b(?) �Site-directed mutagenesis
Introduction
c-Glutamyl transpeptidases (c-GTs; EC 2.3.2.2) belong to
Ntn hydrolase superfamily which catalyzes the cleavage of
c-glutamyl linkage of glutathione (GSH) and subsequently
transfer their c-glutamyl moiety to peptides and amino acid
acceptors (Tate and Meister 1981). They are heterodimeric
proteins coded by a single gene which during the process of
autocleavage, is cleaved into larger and smaller subunit.
The N-terminal nucleophile of smaller subunit is threonine
and is responsible for both autoprocessing and catalysis
(Castellano and Merlino 2012). The enzyme is ubiquitous
in occurrence and is distributed in bacteria and mammals.
This enzyme is involved in glutathione metabolism by
cleaving the glutamyl amide bond and accounts for
intracellular cysteine pool (Pompella et al. 2007; Lee et al.
2004). Apart from its physiological importance, its
biotechnological importance has been recognized in the
synthesis of c-glutamyl peptides, pharmaceutical and food
applications and is also used for debittering of amino acids
(Suzuki et al. 2007). In this respects, several mesophilic
bacterial c-GTs from Bacillus sp. viz., B. licheniformis,
B. subtilis, B. pumilus, and a few thermophilic c-GTs both
from eubacteria and archaea have been biochemically
characterized (Lin et al. 2006; Shuai et al. 2011; Murty
et al. 2011; Castellano et al. 2010, 2011). Thermostable
enzymes are important as they have better activity and
stability. With the advent of whole genome database, it has
become feasible to tap extremophilic archaea for industrial
enzymes (Cavicchioli 2007). Till date, several enzymes
such as amylases, glucosidases and pantothenate kinases
have been characterized from Sulfolobus solfataricus and
Picrophilus torridus (Kim et al. 2004; Takagi et al. 2010).
We report functional expression, biochemical character-
ization and structural analysis of c-glutamyl transpeptidase
Communicated by H. Atomi.
R. Rajput � V. V. Verma � V. Chaudhary � R. Gupta (&)
Department of Microbiology, University of Delhi,
South Campus, New Delhi 110021, India
e-mail: [email protected]
123
Extremophiles (2013) 17:29–41
DOI 10.1007/s00792-012-0490-8
from thermo-acidophilic archaebacteria P. torridus. Based
on in silico study, identified functional residues were
confirmed by site-directed mutagenesis which introduced
transpeptidation.
Materials and methods
Cloning and expression vectors namely pGEM-T easy
vector and pET 51b(?) vector were purchased from
Promega Co., USA and Novagen, respectively. Taq DNA
polymerase, T4 DNA ligase and restriction enzymes
were purchased from New England Biolabs, Beverly,
MA. 5-Bromo-4-chloro-3-indolyl-b-D-galactopyranoside
(X-Gal), isopropyl b-D-thio-galactopyranoside (IPTG) and
carbenicillin were purchased from Sigma-Aldrich Inc.,
USA. Ni2?-NTA purchased from G-Biosciences, USA.
Genomic DNA extraction, Plasmid extraction and gel
elution were performed using the Qiagen DNeasy Blood &
Tissue Kit, Mini prep and gel elution kits purchased from
Qiagen, Hilden, Germany. Recombinant E. coli was grown
at 37 �C in LB broth (10 g of tryptone, 5 g of yeast extract,
and 10 g of NaCl per liter, pH 7.0; Hi-media) supple-
mented with carbenicillin (50 lg/mL). E. coli DH5a and
E. coli Rosetta were used as cloning and expression host,
respectively.
Strain and growth conditions
Picrophilus torridus DSM 9790 was obtained from DSMZ,
Germany and was grown aerobically at 55 �C, 100 rpm at
pH 1.0 for 10 days according to specification from
DSMZ. This medium contained (per liter) KH2PO4 3 g;
MgSO4�7H20 0.5 g; CaCl2�2H2O 0.25 g; yeast extract 2 g;
glucose 10 g; (NH4)2 SO4 0.2 g and pH was adjusted with
concentrated H2SO4 to reach a pH of about 1.0.
Cloning and expression of ptc-gt
Genomic DNA was extracted from P. torridus using Qiagen
DNeasy Blood & Tissue Kit and used as template for PCR
amplification. Primers were designed from the ORF
PTO1185 of c-GT identified from the complete genome of
P. torridus PTO1185 available at NCBI. The sequence of
forward primer along with Kpn I site was 50-GGTACC
AATGTATATGAATTAT-30 and the reverse primer with
Sac I site was 50-GAGCTCATTAGATGATATTTTA-30.The sequence recognized by restriction enzymes was
underlined. The PCR condition consisted of an initial dena-
turation at 95 �C for 5 min followed by 30 cycles of 95 �C
for 30 s, 42.2 �C for 30 s and 72 �C for 2 min, and a final
extension of 10 min at 72 �C. The PCR product of 1.4 kb
was ligated with pGEM-T Easy and transformed into E. coli
DH5a competent cells. Positive colonies were screened by
colony PCR and reconfirmed by fallout analysis.
Expression vector, pET 51b was linearized by double
digestion with Kpn I/Sac I at 37 �C for 16 h followed by
gel elution. The 1.4 kb fallout was ligated overnight into
linearized pET 51b using T4 DNA ligase at 16 �C. The
resulting plasmid was transformed into E. coli Rosetta
cells. The recombinant E. coli with pET 51b-ptc-gt was
cultivated in LB medium supplemented with carbenicillin
(50 lg/mL) at 37 �C/200 rpm until the OD600nm reached
0.5 and then induced with 0.5 mM IPTG. After 3 h incu-
bation, samples were harvested and the cells were sepa-
rated by centrifugation at 74009g for 10 min. Harvested
1 g cell pellet was suspended in 10 mL ice cold 19 PBS
and lysed on ice by sonication at 2 s pulse on and 2 s pulse
off for 10 min, and the lysate clarified by centrifugation
and expression was checked in the clear lysate by c-GT
assay and SDS-PAGE analysis. E. coli Rosetta (DE3) cells
harboring only pET 51b without insert was processed in a
similar manner and taken as control. The expression was
also studied in the presence of hexadecane 1.0–4.0 %, v/v
in LB-carbenicillin medium under same conditions.
Purification of Ptc-GT
Purification of Ptc-GT was performed using Ni–NTA resin
for His-tagged fusion protein 69 HIS-Ptc-GT. The clear
lysate was loaded onto Ni2?-NTA resin (0.5 mL) and left
in the column for 30 min under mild shaking. The column
was washed with 10 column volumes of 50 mM phosphate
buffer, pH 7.5 with 300 mM NaCl and 10 mM imidazole.
Elution of bound protein was performed with 2 column
volume of 50 mM phosphate buffer, pH 7.5 with 300 mM
NaCl in a linear gradient of imidazole (50–500 mM). The
purified protein was then treated with 1 M guanidine
hydrochloride in 1:1 ratio for 30 min at room temperature
and total protein was estimated at 280 nm. The purity of
protein was checked by HPLC on C18 column (Shimadzu,
Japan) using acetonitrile:water (90:10) as mobile phase
with flow rate of 0.5 mL/min and protein was checked on
SDS-PAGE and western blot analysis.
Enzyme assay for c-GT activity
The enzymatic hydrolytic activity was measured using c-
glutamyl-p-nitroanilide (GpNA) as substrate according to
the procedure described by Tate and Meister (1985). The
assay mixture contained 1 mM GpNA and appropriately
diluted enzyme in 50 mM Tris–HCl pH 7.0. The reaction
was incubated at optimum temperature for 5 min and ter-
minated with 100 lL of 3 mM (v/v) acetic acid. The
release of p-nitroaniline was monitored at 410 nm. One
unit of c-GT activity is defined as the amount of enzyme
30 Extremophiles (2013) 17:29–41
123
that releases 1 lmol of p-nitroaniline per minute. Hydro-
lysis of GpNA in the absence of acceptor was considered as
hydrolytic activity and in the presence of acceptor (20 mM
glycyl-glycine) was taken as transpeptidase activity.
Protein estimation
The total protein was estimated spectrometrically by the
method of Bradford (1976) using bovine serum albumin
(BSA) as the standard.
Zymogram analysis of Ptc-GT (Ohlsson et al. 1986)
Purified protein was run on NATIVE-PAGE using 10 %
polyacrylamide gel. After electrophoresis, the gel was
washed with Tris–HCl buffer (50 mM, pH 7.0) for 10 min
on rocker. The gel slab was then overlaid onto agar plate
containing Tris–HCl buffer (50 mM, pH 7.0), mixed with
1 mM GpNA as substrate and incubated at 50 �C till yellow
band appeared. The gel having a yellow band was devel-
oped with 0.1 % (w/v) sodium nitrite in 1.0 M HCl for
5 min under mild shaking (50 rpm) at 25 ± 1 �C and
rinsed thoroughly with distilled water. For another 5 min,
0.5 % (w/v) ammonium sulphamate in 1.0 M HCl was
poured onto the gel and incubated under shaking at
25 ± 1 �C. Excess ammonium sulphamate was removed
by repeated washing with distilled water. At last, band was
treated with N-(1-naphthyl) ethylene diamine in 47.5 %
ethanol, till a pink band corresponding to the yellow band
appeared on GpNA agar plate.
Western blot analysis to detect Ptc-GT
Western blot analysis was performed using a modified
enzymatic chemiluminescence (ECL). The protein was
analyzed on 10 % SDS-PAGE and transferred to PVDF
membrane (Bio-Rad). The membrane was blocked in 3 %
skim milk for 1 h in PBS and proceeded separately for
strep tag and his tag.
Strep-tag detection for larger subunit
The primary antibody, strep protein (1:5000) was added and
the membrane was incubated for 1 h at mild shaking and
washed three times for 10 min with PBS with 0.1 % Tween
20 (PBST). The proteins were visualized with enhanced
chemiluminescence reagent, diaminobenzidine (0.1 % w/v)
solution prepared in hydrogen peroxide for 5 min.
His-tag detection for smaller subunit
Primary antibody, anti-his (1:5000) was added and the
membrane was incubated for 1 h at mild shaking and
washed three times for 10 min with PBS with 0.1 % Tween
20 (PBST). Secondary anti-rabbit antibody (1:5000) con-
jugated with alkaline phosphatase was then added, and
membrane was incubated for 1 h. The membrane was
washed three times with PBST. The proteins were visual-
ized with enhanced chemiluminescence reagents in alka-
line phosphate buffer.
Biochemical characterization of Ptc-GT
Effect of pH and temperature on activity and stability
of Ptc-GT
Effect of pH on c-GT activity was studied in the pH range
from 2.0 to 11.0 using overlapping buffers 50 mM of
Glycine–HCl (pH 2.0), citrate buffer (pH 3.0–6.0), citrate–
phosphate buffer (pH 3.0–7.0), phosphate buffer (pH
7.0–8.0), Tris–HCl buffer ((pH 7.0–9.0), glycine–NaOH
buffer and sodium carbonate-bicarbonate buffer (pH
9.0–11.0) and glycine-phosphate hydroxide buffer (pH
10.0–11.0). Similarly, the effect of temperature on c-GT
activity was determined at different temperatures ranging
from 30 to 80 �C at optimum pH. The activity was
expressed as the percentage relative activity with respect to
maximum activity which was considered as 100 %.
The stability of Ptc-GT was studied over a broad range
of pH and temperature by pre-incubating the enzyme in
buffers of 10 mM of varying pH (2.0–11.0) for 1 h at
25 ± 1 �C and at temperature from 30 to 80 �C for a
period of 2 h and also at 45 �C for 24 h. The enzyme
activity was expressed as the residual activity against the
control which was taken as 100 %.
Effect of inhibitors, reducing agents and metal ions
on the activity of Ptc-GT
Enzyme was pre-incubated with inhibitors viz., azaserine,
DON (6-diazo-4 oxo-norleucine), ethylene diamine
tetraacetic acid (EDTA), ethylene glycol tetraacetic acid
(EGTA), N-bromosuccinimide, iodoacetic acid, p-chlor-
omercuric benzoic acid, phenylmethylsulfonyl fluoride
(PMSF), 1,10-o-phenanthroline (Sigma-Aldrich, USA;
ICN chemicals, USA) and reducing agents namely
b-mercaptoethanol (b-ME) and dithiothreitol (DTT)
(Sigma-Aldrich USA; ICN chemicals, USA) at 25 ± 1 �C
at a final concentration of 5 mM and 10 mM for 15 min.
Similarly, the effect of metal ions was studied by pre-
incubating the enzyme with metal ions viz., Ba2?, Ca2?,
Cd2?, Co2?, Cu2?, Fe2?, Mg2?, Hg2?, Mn2?, Ni2?, Pb2?
and Zn2? at a final concentration of 5 mM and 10 mM for
1 h. Residual activity was measured under standard assay
conditions.
Extremophiles (2013) 17:29–41 31
123
In silico studies
Sequence comparison and phylogenetic analysis of Ptc-GT
Ptc-GT amino acid sequence was downloaded from
microbial genome database (Futterer et al. 2004). PSI-Blast
algorithm was used to create percentage sequence identity
and homology among all the c-GTs sequences including
Ptc-GT (Altschul et al. 1997). Multiple sequence alignment
was performed by ClustalW using default parameters, and
phylogenetic relationship was drawn using UPGMA algo-
rithm (Larkin et al. 2007).
Structural analysis of Ptc-GT
Ptc-GT amino acid sequence was submitted for PSI-Blast
against Protein Data Bank for suitable template selection,
and putative c-GT from Thermoplasma acidophilum
(Tac-GT, PDB code 2I3O) was selected as template for
homology modeling. Modeller 9.10 was used for homology
modeling for wild and mutant (Y327N) types (Eswar et al.
2006). Side chain modifications were done using SCWRL
tool and optimum bond length and bond angles were
attained by energy minimization using AMBER force field
(Canutescu et al. 2003; van der Spoel et al. 1994). Quality
of model was validated by Structural Analysis and Verifi-
cation Server (PROCHECK and WHATCHECK program)
(Laskowski et al. 1993; Hooft et al. 1996). Secondary
structural components were analyzed by PSIPRED and
VADAR server (McGuffin et al. 2000; Willard et al. 2003).
Pocket finder and CASTp were used for active site
predictions (Ruppert et al. 1997; Dundas et al. 2006).
Patchdock and Autodock programs were used for docking
study (Duhovny et al. 2005; Morris et al. 1998). Protparam
server was used for analyzing amino acid composition
(Gasteiger et al. 2005). PyMol, a protein viewer tool was
used for visualization and structural alignment of protein
(Seeliger and De Groot 2010).
Functional validation of active site residues present
in Ptc-GT by site-directed mutagenesis
Based on the structural analysis of larger and smaller
subunit of Ptc-GT, Tyr327, Arg346, Tyr349 and His368
were selected to perform site-directed mutation, where
these residues were replaced with Asn327, Glu327,
Ala346, Glu346, Asp349 and Ser368, respectively. Site-
directed mutagenesis was performed by QuickChangeTM
Site-Directed Mutagenesis Kit (Stratagene). PCR experi-
ment was set up with pET 51b-ptc-gt expression construct
using gene-specific primers according to the protocol pro-
vided with kit. PCR products were digested with the Dpn I,
to remove methylated wild-type plasmid, and 5 lL
amplicon was transformed into E. coli XL-10 cells. Colo-
nies obtained were grown in LB-amp and plasmids were
isolated. Mutated plasmids were then transformed in
expression host, E. coli Rosetta, and mutant proteins were
purified as described earlier for wild protein. The purified
proteins were then characterized kinetically where kinetic
parameters, Km, Vmax and Kcat/Km can be determined by
performing a state kinetics at varying concentrations of
c-glutamyl-p-nitroanilide (0.01–1.0 mM) under optimum
conditions. Kinetic parameters were calculated by
Lineweaver–Burk plot using Sigma Plot software. Com-
parative docking and fluorescence analysis (Varian Cary
Eclipse Fluorescence Spectrophotometer, USA) was done
for mutant Y327N and wild type to support site-directed
mutagenesis outcomes.
Statistical analysis of data
All the above experiments were repeated in triplicate, and
the final values have been presented as mean ± standard
deviation.
Results
Cloning and expression of ptc-gt from P. torridus
PCR amplification using the specific primers resulted in a
1.4 kb gene product which was ligated into pGEM-T Easy
and subcloned into pET 51b. It was transformed in E. coli
Rosetta cells. Expression was studied at 37 �C/200 rpm
with c-GT production of 1.99 U/mg protein after 3 h
of IPTG induction. Unprocessed precursor c-GT was
observed as a major protein of 47 kDa on SDS-PAGE
(Fig. 1a). The addition of 2 % n-hexadecane during pro-
duction enhanced c-GT production to nearly 10-fold with
18.92 U/mg protein after 3 h induction at 37 �C/200 rpm,
and SDS-PAGE showed that c-GT was completely pro-
cessed into mature protein constituted by two subunits,
large and small with apparent molecular mass of 30 kDa
and 17 kDa, respectively (Fig. 1a).
Purification of Ptc-GT
Ptc-GT was purified by Ni2?-NTA matrix with a purifi-
cation fold and recovery of 3.6 and 61 %, respectively. The
purity of purified protein was confirmed further by HPLC
on C18 column using UV detector (data not shown). The
protein was a heterodimer with subunits of 30 and 17 kDa
as revealed by SDS-PAGE and confirmed by western blot
analysis, the larger subunit as strep protein and the smaller
subunit as his protein (Fig. 2a). The activity of Ptc-GT was
confirmed by zymogram on GpNA agar plate where the
32 Extremophiles (2013) 17:29–41
123
released p-nitroaniline was diazotized with N-(1-naphthyl)
ethylenediamine to a red azo dye and developed a pink
zone of GpNA hydrolysis coinciding with the protein band
on the NATIVE-PAGE (Fig. 2b).
Biochemical properties of Ptc-GT
Effects of pH and temperature on the activity and stability
of Ptc-GT
Ptc-GT was active over a wide pH range, 4.0–9.0 with
[40 % of hydrolytic activity and optima at 7.0 (Fig. 3a).
The enzyme was active over temperature 40–60 �C with
[50 % activity having maxima at 55 �C (Fig. 2b).
The enzyme was stable within a pH range 3.0–10.0 with
[50 % residual activity (Fig. 3a). The protein was found
100 % stable at 45 �C after 24 h with a t1/2 of 1 h at 50 �C
and 30 min at 60 �C (Fig. 3b).
Effects of inhibitors, reducing agents and metal ions
on the activity and stability of Ptc-GT
Ptc-GT was completely inhibited by 1 mM azaserine,
DON (6-diazo-4 oxo-norleucine) and PMSF (data not
shown). It retained [90 % activity in the presence of
10 mM chelating agents like EDTA, EGTA and 1, 10-o-
phenanthroline and was not inhibited by N-bromosuccini-
mide and iodoacetic acid (data not shown). However,
reducing agents like DTT and b-mercaptoethanol have no
significant effect on the activity of the enzyme (data not
shown). The enzyme retained [90 % activity in the pres-
ence of most of divalent cations like Ba2?, Ca2?, Co2?,
Cd2?, Fe2?, Hg2?, Mg2?, Mn2? and Zn2?. However, it
retained 40 % activity in presence of Cu2? and Ni2? (data
not shown). Besides, mutant Y327N retained [90 %
transpeptidase activity in the presence of Ba2?, Ca2?,
Cu2?, Mg2?, Mn2?, and Zn2? and was completely inhib-
ited by Cd2?, Co2?, Fe2?, Hg2?, Ni2 and Pb2? (data not
shown).
Fig. 1 Expression profile of Ptc-GT after 3 h at 37 �C/200 rpm. a SDS-
PAGE profile: Lane 1 protein marker, Lane 2 pET 51b-Ptc-GT only,
Lane 3 pET 51b-Ptc-GT ? IPTG (0.5 mM), Lane 4 pET 51b-
Ptc-GT ? IPTG ? hexadecane (1 %), Lane 5 pET 51b-Ptc-GT ?
IPTG? hexadecane (2 %), Lane 6 pET 51b-Ptc-GT ? IPTG ? hexa-
decane (3 %), Lane 7 pET 51b-Ptc-GT ? IPTG ? hexadecane (4 %).
b Data were analyzed using Student’s t test where filled bars havingalphabets (a, b, c) are statistically different
Fig. 2 Purification profile of Ptc-GT. a SDS-PAGE profile and
western blot of purified protein: Lane 1 protein marker, Lane 2 pET
51b-Ptc-GT only, Lane 3 pET 51b-Ptc-GT ? IPTG (0.5 mM), Lane4 purified Ptc-GT on Ni2?-NTA, Lane 5 strep-tag blot of pET 51b-
Ptc-GT only, Lane 6 strep-tag blot of Ptc-GT, Lane 7 his-tag blot of
pET 51b-Ptc-GT only Lane 8 his-tag blot of Ptc-GT. b Zymogram of
Ptc-GT on NATIVE-PAGE: Lane 1 pET 51b-Ptc-GT only, Lane 2Ptc-GT, Lane 3 zymogram of pET 51b-Ptc-GT only, Lane 4zymogram of Ptc-GT
Extremophiles (2013) 17:29–41 33
123
Comparative sequence analysis of Ptc-GT with other
bacterial and eukaryotic c-GTs
Comparative sequence analysis of Ptc-GT with other bacte-
rial and eukaryotic c-GTs revealed that Ptc-GT does not
share significant identity and homology with any of the
c-GTs (Table 1). It shared the highest sequence identity
of 37 % and homology of 53 % with an extremophile
Thermoplasma acidophilum (data not shown). Further, phy-
logenetic analysis revealed three distinct clusters of c-GTs
belonging to non-extremophiles, eukaryotes and then to extr-
emophiles. Among these, Ptc-GT was found closely related
to c-GTs of other extremophiles and thermophiles (Fig. 4).
Multiple sequence alignment of Ptc-GT with other ex-
tremophiles, thermophiles and E. coli c-GTs revealed con-
served primary and secondary structure among all c-GTs
(Fig. 5). The putative internal cleavage site for large and
small subunit of Ptc-GT was predicted as Thr308, conserved
among all the c-GTs. The most critical difference of the
Ptc-GT when compared with E. coli c-GT (Ecc-GT) was
absence of lid loop in comparison to Ecc-GT (residues P438-
G449) (Okada et al. 2006). Further, c-glutamyl binding
moiety residues Thr409, Gly483, Gly484 of E. coli were
found conserved in Ptc-GT as Gly387, Gly388 (oxyanion
hole residues) whereas Thr409 is replaced by Ser325 in
Ptc-GT similar to other extremophiles (Ruepp et al. 2000;
Boanca et al. 2007). Other active residues known for Ecc-GT
were Arg114, Asn411, Gln430, Asp433, Leu461, Ser462,
Ser463, Pro482 and Ile487 were different in Ptc-GT as Ser68,
Tyr327, Arg346, Tyr349, Phe367, His368, Thr369, Met386
and Gln391, respectively. However, these binding residues of
Ptc-GT were observed to be conserved and semi-conserved
in c-GTs from other extremophiles and thermophiles.
Structural analysis of Ptc-GT
Model of Ptc-GT was built to identify structural basis that
could be accounted for comparing functional properties of
pH
1 2 3 4 5 6 7 8 9 10 11 12
Rel
ativ
e ac
tivity
(%
)
0
20
40
60
80
100
120
pH
Res
idua
l act
ivity
(%
)
Temperature (°C)
25 30 35 40 45 50 55 60 65 70 75
Rel
ativ
e ac
tivity
(%
)
0 20 40 60 80 100 120
Res
idua
l act
ivity
(%
)
45°C50°C60°C70°C
Ptγ-GT was 100% at 45°C after 24 h
0
20
40
60
80
100
120
0
20
40
60
80
100
120
1 2 3 4 5 6 7 8 9 10 11 120
20
40
60
80
100
120
Temperature (°C)
A
B
Fig. 3 Effect of pH (a) and temperature (b) on the activity of Ptc-GT. 100 % Activity corresponds to 33 U/mg protein
34 Extremophiles (2013) 17:29–41
123
Ptc-GT with other c-GTs. As Tac-GT showed the highest
sequence identity with Ptc-GT, it was selected as template
for homology modeling. Crystal structure of Tac-GT has
been available in Protein Data Bank but description has not
been reported in literature. The stereochemical quality of
final model showed that 89.6 % residues positioned in most
favorable region and 0.0 % residues positioned in disal-
lowed region of Ramachandran plot. Root mean square
deviation (RMSD) value in the Ca positions between
template and modeled structure was observed as 1.504 A.
Similar to crystal structures of c-GT from Ecc-GT and
Tac-GT, the modeled structure of Ptc-GT also showed a
abba-core structure where central b-sheets were sand-
wiched by a-helices. Modeled structure of Ptc-GT was
selected as primary source for further analysis (Fig. 6a).
Identified active site of Ptc-GT was cross validated by
comparing modeled structure of Ptc-GT with crystal structure
of Ecc-GT. c-Glutamyl moiety was docked into active site of
Ptc-GT model. Stereoview of the Ptc-GT enzyme complex
with glutathione showed that this substrate is perfectly docked
Table 1 Parameters related to the amino acid composition of
P. torridus compared with E. coli and G. thermodenitrificans
Amino acid parameters Ptc-GT Ecc-GT Gtc-GT
Number of protein residues 478 580 534
Molecular weight (Da) 53,279.1 61,767.9 57,668.5
Total number of uncharged polarresidues Gln ? Asn ? Thr ? Ser(%)
22.5 20.4 15.3
Total number of hydrophobicresidues (Ala ? Val ? Ile ? Leu) (%)
27.9 31 31.9
Number of Arg (R) (%) 2.9 2.8 4.1
Number of Lys (K) (%) 6.1 6.7 3.7
Arg/Lys 0.48 0.42 1.11
Arg/(Arg ? Lys) 0.32 0.29 0.53
Total number of positively chargedresidues (Arg ? Lys) (%)
9.0 9.5 7.8
Total number of negatively chargedresidues (Asp ? Glu) (%)
10.6 11.4 10.1
(Asp ? Glu)/(Arg ? Lys) 1.23 1.2 1.29
Total number of charged residues(Glu ? Asp ? Lys ? Arg) (%)
19.6 20.9 17.9
Total number of Gly (%) 8.6 9.7 10.7
Total number of Pro (%) 3.8 6.0 7.7
Fig. 4 Phylogram of c-GTs.
The amino acid sequences of
c-GTs were used from
Escherichia coli (NP417904),
Salmonella enterica(YP005244539), Francisellatularensis (YP005318273),
Helicobacter pylori(NP207909), Yersinia pestis(NP668315), Burkholderiamallei (YP105670), Bacillussubtilis (NP389723),
Staphylococcus aureus(YP185087), Bacillus anthracis(YP002860670), Pig
(NM214030), Human
(NM005265), Rat (NM053840),
Mouse (Q60928), Bacillushalodurans (NP241733),
Geobacillus thermodenitrificans(YP001127364), Deinococcusradiodurans (Q9RU70),
Thermus thermophilus(YP004378), Picrophilustorridus (YP023963),
Thermoplasma acidophilum(NP394454). Online available
ClustalW tool and UPGMA
algorithm with default
parameters was used for
phylogenetic prediction
Extremophiles (2013) 17:29–41 35
123
inside the cavity of active site. Binding cavity of Ptc-GT was
empty because of the lack of lid loop toward the active site of
Ptc-GT, but it was observed in Ecc-GT. All the residues
proposed to be a part of binding site, whereas the active
residues for acceptor binding site produced by multiple
sequence alignment were found in the cavity (Fig. 6b).
Functional validation of active side residues
by site-directed mutagenesis
Functional residues identified by in silico approaches were
further validated by site-directed mutagenesis where
Tyr327 and His368 of Ptc-GT mutated by Asn327 and
P.torridus --------------------------------------------MYMNYAVASSHPLSTF 16 T.acidophilum ------------------------------------MFRSRPNALSQRSVIASSSELASL 24 G.thermonitrificans ---------------------------MDYLYHP--YPSQRMTVFAKNGIVATSQPLAAQ 31 B.halodurans -----------------------MSVMFDPQSYP--YPSRRNVVYAKNGMVATSQPLAAQ 35 D.radiodurans --------------------------MLRPMTHNPEYPVVRRPAYARRGMVATSQPLAAQ 34 T.thermophilus ---------------------------MDLTYYP--YPSRRHVVLGRRGAVATSQPLAAL 31 E.coli MIKPTFLRRVAIAALLSGSCFSAAAAPPAPPVSYGVEEDVFHPVRAKQGMVASVDATATQ 60 . :*: :: P.torridus VGNEILKDGGNAYDAAIATSAALVVVQPHLNGLGGDFFSTIIDN--DIYSINGSGNAPEL 74 T.acidophilum AGRDILKRGGNIFDAALAVSAMLCVTQNNLCGLGGDLFALIRDENGQIMDLNGSGQASRA 84 G.thermonitrificans AGLEVLKKGGNAIDAAIATAACLTVVEPTSNGIGGDAFALVWTNG-KLYGLNASGYAPAA 90 B.halodurans AGLDILKAGGNAIDAAIATATALTVLEPTSNGIGSDAFALVWTKG-KLHGLNGSGRAPMS 94 D.radiodurans AGLSILQAGGNAVDAAVATAAALTVVEPTSNGLGGDAFALVWAGG-ELHGLNASGAAPAA 93 T.thermophilus AGMEVLLKGGSAVDAAIAMAACLTVVEPTSNGIGGDLFALVWDG--TLHGLNASGKSPMA 89 E.coli VGVDILKEGGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRSKNGNTTAIDFREMAPAK 120 .* .:* **. ***:* . * * . .:*.. * : :: :. P.torridus ATIEFFHRNGYNKIPEQGPLSSFS--IPGLVSSWEILYKN-ATMKLEKLFSRAISFAMDG 131 T.acidophilum VSIDYYESMGLTKIPERGPYAAIT--VPGIAGSWDEIFRKFATMDIADILEPAIRTASAG 142 G.thermonitrificans ISLDVLKERGYT-EMPKYGFAPVT--VPGAPAAWAALSKRFGRLSLAETLAPAIAYAENG 147 B.halodurans LTMEAVKAKGYEQELPPYGVIPVT--VPGAPGAWAELAKMYGNLPLAASLAPAIRYAEEG 152 D.radiodurans LSLEALP----GGEMPKYGWTPVT--VPGAVRGWTDLHGRFGRLDFAQVLAPAIRYAREG 147 T.thermophilus LTPERLP-----GRMPERGWLPVT--VPGAVSGWRALHERWGRLPFAEVLAPAIRYAEEG 142 E.coli ATRDMFLDDQGNPDSKKSLTSHLASGTPGTVAGFSLALDKYGTMPLNKVVQPAFKLARDG 180 : : .: ** .: . : : . *: * * P.torridus FIPSNSILKAIKN---FKYGDVDFN------NIYYNNE------RLLVQRALGKTLKLLA 176 T.acidophilum FPITQNYSDSIARSAPVIGQYRGWS------SIFMPNGSVPVAGEILKQPDLAESFRLMS 196 G.thermonitrificans YPVSPVLGKYWANAYRVYKEALHGPEFGSWFETFAPAGRAPNIGEVWASPDHAATLRSIA 207 B.halodurans YPVTPTLAKYWKAAYDRVKTEWTDDVYQPWFDTFAPKGRAPRVGEVWRSQGHADTLRSIA 212 D.radiodurans YPLSPVLAANWARAIRSY-WALNLPIFEDWFRTFAPDGFTPRPGALWRSEGHARTLELIA 206 T.thermophilus FPVGPETARSWRRAEGVF-LPLEGPEFGPFKEVFFPGGRAPRAGEVWRSPLHAKTLREIA 201 E.coli FIVNDALADDLKTYGSEVLPNHENSK-----AIFWKEGEPLKKGDTLVQANLAKSLEMIA 235 : : . . ::. :: P.torridus EKGLESFYHGDIARAIEDDMIKKHGLIRFNDLDSYSASVVKPLEIRYRNYSVYTNPP-VS 235 T.acidophilum EEGFRSFYDGSLADIIIAGLEGTGSPLSDRDLRVYRPLIGKPVFTDLDEFRIYETSP-NS 255 G.thermonitrificans ETEAESFYRGELAEKIVAFSKQYNGFLTLEDLAEYEPEWVEPISVSYHGYDVWEIPP-NG 266 B.halodurans ESNGESFYRGELADQIHAFFDKHGGYLTKEDLACYRPEWVEPISIDYRGYRVWEIPP-NG 271 D.radiodurans QTGGAAFYEGELAGQIDAHAQATGGLLRGSDLAAHRSEWVKPIHTDWLGHRVYEIPP-NG 265 T.thermophilus ESYGESLYRGALAEALLRFSEATGGLLTREDLEAHAPEWVTPLSTEYKGLTVWELPP-NG 260 E.coli ENGPDEFYKGTIAEQIAQEMQKNGGLITKEDLAAYKAVERTPISGDYRGYQVYSMPPPSS 295 : :* * :* : . : ** : . *: :: .* . P.torridus QGATALYWLNRLNKYDLYT--MPDDLYYSSLINEMYPSYEFRKSMIYDGSS-ISNDDLLN 292 T.acidophilum QGITVIEWIRGMESHGYDSR-TMWEAKIEDIFETMEEAYDKRRKITDPSYMNIAQHDSAN 314 G.thermonitrificans QGLVALMALNIMNGFDVPNV--PDVETYHRQIEAMKLAFADGKAYIADRRYMNYRVDELL 324 B.halodurans QGLVALEALNIVKGFEFYHK--DTVDTYHKQIEAMKLAFVDGMKYVTEPSDMSVSVEQLL 329 D.radiodurans QGIAALVALNVLGAERLPEL-RDDPAGLHLQIEAMKRGFHDAHSYVADPRHVPVDVEGLL 324 T.thermophilus QGVAVLLALNLLEGFDLRPE---DPWSYHVQIEAMRLALADTYRFVADPRHMELAPEAFL 317 E.coli GGIHIVQILNILENFDMKKYGFGSADAMQIMAEAEKYAYADRSEYLGDPDFVKVPWQALT 355 * : :. : : . : P.torridus NYSYSK-------NKKDE-------------KYSDTTAFSVFDGDAG-ISAIQSNYMGFG 331 T.acidophilum GKKDGL-------PKRDHN------------DIGDTTYFSISDSEGRSVSIIQSNYMGFG 355 G.thermonitrificans SESFAA-------MRRAQIGTEALTPEPGTPPKGGTVYLAAADGEGNMVSFIQSNYMGFG 377 B.halodurans SDEYAT-------ERRKEIGEQALTPEPGTPPRGGTVYLATADGDGNMVSFIQSNYMGFG 382 D.radiodurans SAANAE-------RHRALLGEQAHDPATHAPSTGGTVYLAAADDEGGMVSMIQSNYMGFG 377 T.thermophilus SKAYAA-------ERRRLIGERALPRVLPGLRPEGTVYLAAADG-EVMVSLIQSNYQGFG 369 E.coli NKAYAKSIADQIDINKAKPSSEIRPGKLAPYESNQTTHYSVVDKDGNAVAVTYTLNTTFG 415 . . .: *. : * :: : ** P.torridus SGHSIHGYGINMNNRGSYFTLDKNHK----------NALKPGKKTFHTLMS-TILN--GD 378 T.acidophilum SGIVPKGTGFVLQNRGSYFTLQRDHP----------NALMPGKRTFHTLAA-CMVEKEHD 404 G.thermonitrificans SGLVVPGTGIALHNRGHNFVFDENHP----------NGLAPRKKPYHTIIPGFLTKGG-K 426 B.halodurans SGVVVPGTGIAMQNRGHNFSLDPNHD----------NALKPGKRTYHTIIPGFLTKND-Q 431 D.radiodurans SGVVVPGTGIALHNRGHNFHTDPAHP----------NALAPGKRPYHTIIPGFLGRADGT 427 T.thermophilus SGVLVPGTGIALQNRGLGFSLEEGHP----------NRVGPGKRPFHTIIPGFLAREG-K 418 E.coli TGIVAGESGILLNNQMDDFSAKPGVPNVYGLVGGDANAVGPNKRPLSSMSPTIVVKDG-K 474 :* *: ::*: * . * : * *:. :: . : . P.torridus KLILLGSMGGDIQPQVNVQIITRIIDLNYNIQDAISYPRFAYPASIYG--------DADL 430 T.acidophilum LYASLGSMGGDIQPQVQMQILMEILKDNTDPQAILDKPRWTEPYTIYEAPGAVYVESEEL 464 G.thermonitrificans PIGPFGVMGGFMQPQGHMQVIMNTVDFALNPQAALDAPRWQWMEGKTVLVEP---HFPRH 483 B.halodurans PIGPFGVMGGFMQPQGHMQVMMNTIDFGLNPQAALDAPRWQWTNGKQVQVEP---TFPVD 488 D.radiodurans PVGPFGVMGGFMQPQGQLQVVVNTVRYGMNPQQALDAPRWQWLQGRTVEVEP---ALGDQ 484 T.thermophilus PLGPFGVMGGFMQPQGHVQVVVGLADFGLNPQAALDRPRWQVVPGDEVLLEP---GIPQA 475 E.coli TWLVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLPDELRVEKG--FSPD 532 * ** :*:: : . **: P.torridus YS--EKGIVPGSKYIDGLSSMMGHAQG--ILIEDDVHAGFDPRGDGLLKYHL------- 478 T.acidophilum YRNVSKQISGRKVVLRDVSQEFGTAQITTLIRGDVVVGAADPRGDGIAIPYS------- 516 G.thermonitrificans IAEALARKGHDICVALDGGPFGRGQIIWRDPDTGVLAAGTEPRTDGAVAAW-------- 534 B.halodurans IAQALVRRGHKIQVVLDEGAFGRGQIIWRDPTTGVLAGGTEPRTDGQVAAWEGHHHHHH 547 D.radiodurans LARALVARGHDVRVQLDPGSFGRGQMIRRDPDTGVLEGGTESRTDGHIALW-------- 535 T.thermophilus TALFLKDLGHRVRYEAEYGLFGRGQVVFR--LGEALVGASDPRAEGLALAW-------- 524 E.coli TLKLLEAKGQKVALKEAMG----STQSIMVGPDGELYGASDPRSVDDLTAGY------- 580
Fig. 5 Multiple sequence
alignment of Ptc-GT with other
extremophiles and thermophiles
c-GTs. Ptc-GT was aligned
with T. acidophilum,
G. thermonitrificans,
B. halodurans, D. radiodurans,
T. thermophilus and E. colic-GTs by ClustalW. The
conserved residues Thr (T308 in
Ptc-GT) crucial for
autoprocessing are highlighted
in red. Oxyanion hole residues
Gly, Gly (G387, G388 in
Ptc-GT) conserved among all
c-GTs are highlighted in green.
Other active site residues which
are conserved or semi-
conserved (S68, S325, Y32,
R346, Y349, F367, H368, T369,
M386 and Q391 in Ptc-GT)
among all c-GTs are highlighted
in cyan. Lid loop extending
toward the active site (from
P438 to G449 of Ecc-GT) and
absent in Ptc-GT and other
c-GTs are underlined and
highlighted in magenta. Signal
peptide in Ecc-GT is underlinedand highlighted in dark(Castellano et al. 2010, 2011;
Futterer et al. 2004; Ruepp et al.
2000; Takami et al. 2000;
Suzuki et al. 1986) (color figure
online)
36 Extremophiles (2013) 17:29–41
123
Ser368 to that of E. coli introduced significant transpepti-
dase activity in both the mutants. The catalytic efficiency
was 10.94 ± 1.0 min-1 lM-1 and 10.37 ± 1.5 min-1 lM-1
for mutants, Y327N and H368N, respectively (Table 3).
However, both mutations resulted in lowering of Km and
declined in hydrolytic rate. Comparative docking analysis of
mutant Y327N and wild type with acceptor glycyl-glycine
revealed that the ligand docked perfectly in binding pocket of
mutant where five residues (L87, E90, Y305, N327, S348)
hydrogen bonded with glycyl-glycine, in contrast to wild type,
where the acceptor did not dock perfectly in binding pocket
and only four residues (S348, F350, T351, Y425) were
hydrogen bonded (Fig. 7a, b), and the catalytic nucleophile
(T308) was found to be away from ligand binding core. This
is further strengthened by comparative fluorescence emission
analysis where a fluorescence shift from 330 nm of mutant
Y327N without acceptor to 320 nm in case of DOPA and
345 nm in the presence of glycyl-glycine and ethylamine,
respectively, was observed while only quenching was
observed in case of wild type in the presence of acceptors
(Fig. 7c, d).
Thermostability of Ptc-GT
To analyze the molecular features responsible for adapta-
tion to extreme condition in c-GTs, some parameters
related to amino acid composition (Table 1) and structure
(Table 2) of Ptc-GT were analyzed and compared in detail
with a mesophilic, Ecc-GT and a thermophilic, Gtc-GT.
Compositional amino acid analysis of Ptc-GT revealed
that, when compared with Ecc-GT and Gtc-GT, the protein
has higher uncharged polar residues Gln, Asn, Thr and Ser,
coupled with lower Arg/Lys ratio than Gtc-GT but higher
than Ecc-GT (Table 2). Larger content of arginine favors
protein thermostability whereas larger content of lysine
decreases protein thermostability, which is in accordance
with Szilagyi and Zavodsky (2000). Ptc-GT amino acid
sequence contains higher content of charged residues Glu,
Asp, Lys and Arg as compared to Ecc-GT and Gtc-GT; this
is in support of Ptc-GT thermostability (Haney et al. 1999).
To identify structural basis for thermostability of
Ptc-GT, detailed structural features of all three c-GTs were
analyzed (Table 3). Ptc-GT showed higher total accessible
surface area, mean residue accessible surface area and
mean residue volume with respect to Ecc-GT and Gtc-GT.
Ptc-GT also showed higher molecular mass and volume
similar to Ecc-GT and Gtc-GT (De Vendittis et al. 2008).
Discussion
Extremophiles are an unlimited reservoir of enzymes with
potential biotechnological properties, since extremophilic
conditions lower the risk of contamination in addition to
better solubility of substrates (Burg 2003). Among thermo-
philes and extremophiles, archaea are relatively a less
explored group due to extreme culture conditions and slow
growth rate. However, tapping these organisms has now
become possible due to growing whole genome database.
Among these, Picrophilus torridus, a thermo-acidophilic
archaeon has gained attention in the recent times because of
its ability to live under highly acidic, at pH values close to pH
0.0 (Angelov et al. 2006). Previously few enzymes namely
pantothenate kinase, a-mannosidase and a-glucosidase,
2-keto-3-deoxygluconate-specific aldolase, glucose/galactose
dehydrogenase and glucoamylase have been described in
P. torridus (Takagi et al. 2010; Angelov et al. 2005; Reher
et al. 2010; Angelov et al. 2006; Schepers et al. 2006).
Fig. 6 Three-dimensional representation of monomeric form and
binding pocket. a The monomeric form of modeled Ptc-GT structure
where b-sheets were sandwiched by a-helices. Large subunit com-
ponent a-helices showed in green, cyan and lemon color and b-sheets
showed in blue and green colors; whereas small subunit component
a-helices showed in brown and b-sheets in red color. b Binding mode
of c-glutamyl moiety (dotted form) inside the active site of Ptc-GT
(color figure online)
Extremophiles (2013) 17:29–41 37
123
The gene, ptc-gt from P. torridus was cloned and
expressed in pET 51b-E. coli Rosetta cells using IPTG
induction. However, the enzyme was mostly recovered as
pro-c-GT in an inactive form. The autoprocessing of the
enzyme was poor but was enhanced to nearly 10-fold when
recombinant E. coli was grown in the presence of
n-hexadecane. This is in confirmation with the earlier
reports where use of oxygen vectors has been suggested to
improve the yield of recombinant proteins by improving
oxygen transfer rate (Giridhar and Srivastava 2000). c-GT
of P. torridus was found to be heterodimeric protein
composed of two subunits with apparent molecular mass of
30 and 17 kDa, respectively, which is in confirmation with
other c-GTs, encoded by a single gene and processed into
two subunits, large and small (Boanca et al. 2006; Suzuki
and Kumagai 2002; Kinlough et al. 2005).
c-GT was purified using nickel affinity chromatography
with a recovery of 61 % and studied biochemically.
Ptc-GT displayed only hydrolase activity which is in
agreement with other thermophiles and extremophiles such
as T. thermophilus and D. radiodurans, and G. thermo-
denitrificans which all are reported to be hydrolytic
(Castellano et al. 2010, 2011). More than 50 % of enzymes
were active over a broad pH range from 4.0 to 8.0 and
optima at pH 7.0. Generally, c-GTs from various organisms
are reported to be maximally active at pH 8.0 with slight
activity in acidic pH range (Tate and Meister 1985; Wang
et al. 2008). The enzyme was acid stable and has[50 % of
activity even at pH 2.0 in contrast to earlier reports where
c-GTs are known to be stable between neutral and alkaline
range (Tate and Meister 1985; Wang et al. 2008). This
property may be attributed to the differences in amino acid
Wavelength (nm)290 30
0310 32
0330 340 35
036
037
038
0390 400 41
042
043
044
0450 460
Flu
ores
cenc
e In
tens
ity (
au)
0
100
200
300
400
500
600
700
800
900
1000
Y327N
Y327N+Ethylamine
Y327N+L-DOPA
Y327N+Glycylglycine
Wavelength (nm)29
030
031
032
033
034
035
036
037
038
039
040
041
042
0430 44
045
046
0
Flu
ores
cenc
e In
tens
ity (
au)
0
50
100
150
200
250
300
350
400
Ptγ – GT
Ptγ – GT+Ethylamine
Ptγ – GT+L-DOPA
Ptγ – GT+Glycylglycine
a b
c d
Fig. 7 a, b Binding mode of glycyl-glycine with mutant (Y327N)
and wild. a Glycyl-glycine strongly held up by five residues (L87,
E90, Y305, N327, S348) where N327 of mutant makes two hydrogen
bonds with glycyl-glycine. b Binding mode of glycyl-glycine
with wild enzyme where it was weakly held up by four residues
(S348, F350, T351, Y425) where nucleophile (T308) is found to be
far away from ligand binding core. c, d Comparative fluorescence
emission spectrum with acceptors glycylglycine, ethyl amine and
DOPA of c mutant d wild types
38 Extremophiles (2013) 17:29–41
123
composition which would have been due to evolutionary
selection due to the acidic habitat of P. torridus. The
enzyme exhibited[50 % of activity between 40 and 60 �C
with optima at 60 �C similar to other c-GTs from meso-
philes and extremophiles (Suzuki and Kumagai 2002; Abe
et al. 1995). However, it was highly thermostable with a
t1/2 of 1 h at 50 �C and 30 min at 60 �C and retained
100 % activity even after 24 h at 45 �C which is similar to
G. thermodenitrificans which retained up to 80 % activity
under same conditions (Castellano et al. 2010). However,
c-GT from E. coli and Bacillus were comparatively ther-
molabile where c-GTs were inactivated at [45 �C within
15 min–1 h (Suzuki and Kumagai 2002; Abe et al. 1995).
The amino acid sequence and structural features which are
known to govern thermostability were found to fit well
with experimentally observed thermostability in Ptc-GT
(Szilagyi and Zavodsky 2000; Haney et al. 1999; De
Vendittis et al. 2008). It showed high arginine and charged
amino acid content along with larger molecular mass and
protein volume similar to that of G. thermodenitrificans
(Castellano et al. 2010).
The catalytic properties suggested that the present
enzyme was different from E. coli as it did not show
transpeptidation. The position-specific multiple sequence
alignment and structural analysis suggested that only two
residues Gly386 and Gly387 were conserved in Ptc-GT and
all the rest binding sites were different. However, all these
residues of Ptc-GT were conserved and semi-conserved in
extremophiles. This suggests that the differences in binding
residues of extremophiles may be the key reason of
extremophilic c-GTs being only hydrolytic in contrast to
E. coli. Therefore, these residues were mutated to that of
E. coli. Tyr327 and His368 of Ptc-GT mutated by Asn327
and Ser368, respectively, introduced significant transpep-
tidase activity in both the mutants. None of the other
mutations could introduce transpeptidase activity. How-
ever, in all the mutations, the hydrolysis rate declined with
lowering of Km, indicating the improved substrate binding
efficiency after mutations. This is well supported by
comparative docking analysis of mutant and wild protein
with glycyl-glycine as acceptor substrate. The acceptor was
observed to be held by six hydrogen bonds in Y327N
mutant in contrast to the wild, where the acceptor was not
held properly in the binding pocket. This indicates that the
transpeptidase activity in case of mutant is due to the
change in protein conformation resulting in better acceptor
binding. This is further strengthened by fluorescence shift
of mutant, Y327N in the presence of acceptors like glycyl-
glycine, DOPA and ethylamine while no such shift was
observed in case wild protein. Mutation studies suggest that
the differences lie in acceptor site of pocket, and due to
Table 2 Structural parameters of P. torridus compared with E. coliand G. thermodenitrificans
Structural parameters Ptc-GT Ecc-GT Gtc-GT
Total accessible surface area
(ASA, A2)
38,510 37,745.4 38,449
Accessible surface area of
backbone (A2)
4,798.2 4,935.6 4,354
Accessible surface area of side
chain (A2)
33,711.8 32,810 34,095
Mean residue ASA (A2) 45.1 34.4 36.3
Exposed non polar ASA (A2) 21,949 22,343 22,040
Exposed polar ASA (A2) 8,745.8 7,861.6 7,591.6
Exposed charged ASA (A2) 7,815.2 7,541 8,817.2
Fraction non polar ASA (%) 57 59 57
Fraction polar ASA (%) 23 21 20
Fraction charged ASA (%) 20 20 23
Total volume (A3) 128,518.8 144,928.8 139,736.8
Mean residues volume (A3) 150.5 132 132.1
b-Sheet content (%) 26 24 27
a-Helix content (%) 30 36 35
Coil content (%) 42 38 37
Fraction residues with hydrogen
bond (%)
70 78 77
Table 3 Steady state kinetics of Ptc-GT versus mutants
Protein Hydrolytic activity (without acceptor) Transpeptidase activity (with acceptor)
Km (lM) Vmax
(lmoles-1 ml-1 min-1)
Kcat/Km
(min-1 lM-1)
Km (lM) Vmax
(lmoles-1 ml-1 min-1)
Kcat/Km
(min-1 lM-1)
Ptc-GT 100 ± 1.2 5.0 ± 1.8 2.36 ± 1.1 – – –
Y327N 66.6 ± 1.0 1.6 ± 1.6 1.50 ± 1.3 25.0 ± 0.6 5.8 ± 0.4 10.94 ± 1.0
H368S 14.3 ± 0.9 2.0 ± 1.0 6.06 ± 2.0 25.0 ± 1.3 5.5 ± 0.5 10.37 ± 1.5
Y327E 66.6 ± 1.0 3.3 ± 1.6 3.60 ± 1.7 – – –
R346A 28.6 ± 1.4 2.2 ± 1.2 3.26 ± 1.0 – – –
R346E 66.0 ± 0.5 4.0 ± 1.0 2.86 ± 1.4 – – –
Y349D 66.6 ± 1.2 1.3 ± 0.9 2.34 ± 1.4 – – –
Extremophiles (2013) 17:29–41 39
123
these differences, Ptc-GT has lost transpeptidase activity as
evident by the recovery of transpeptidase activity on
mutations, Y327N, and H368S. Phylogenetic analysis also
revealed three clusters of extremophiles, mesophiles and
eukaryotes, again supporting the evolutionary divergence
of extremophiles.
Conclusion
In the present study, c-glutamyl transpeptidase of a thermo-
acidophilic archaeon Picrophilus torridus was cloned and
expressed using E. coli Rosetta-pET 51b(?) expression
system. The enzyme was expressed at 37 �C/200 rpm after
3 h of IPTG induction. It was improved nearby 10-fold in
the presence of 2 % hexadecane. The recombinant protein
was synthesized as a precursor heterodimeric protein of
47 kDa with two subunits of 30 kDa and 17 kDa, respec-
tively. The enzyme was characterized biochemically and
found to be acid and thermo stable at a significant level. In
silico approaches showed a lot of differences in binding
residues of Ptc-GT with respect to Ecc-GT except Thr308
as autoprocessing and enzymatic residues, and Gly387 and
Gly388 as oxyanion hole residues. Ptc-GT residues were
found to be conserved or semi-conserved in other
extremophiles c-GTs which was also hydrolytic in nature.
Mutation at binding pocket residue, i.e., Tyr327 mutated to
Asn327 to that of E. coli introduced significant transpep-
tidase activity which was well supported by comparative
docking and fluorescence analysis spectra of mutant and
wild with acceptor substrates.
Acknowledgments Financial assistance from DU/DST-PURSE
grant and Misc. R & D Grant, University of Delhi is acknowledged.
References
Abe K, Ito Y, Ohmachi T, Asada Y (1995) Purification and properties
of two isozymes of gamma glutamyltranspeptidase from Bacillussubtilis TAM-4. Biosci Biotechnol Biochem 61:1621–1625
Altschul SF, Madden TL, Schaffer AA, Zhang J, Zhang Z, Miller W,
Lipman DJ (1997) Gapped BLAST and PSI-BLAST: a new
generation of protein database search programs. Nucleic Acids
Res 25:3389–3402
Angelov A, Futterer O, Valerius O, Braus GH, Liebl W (2005)
Properties of the recombinant glucose/galactose dehydrogenase
from the extreme thermoacidophile, Picrophilus torridus. FEBS
J 27:1054–1062
Angelov A, Putyrski M, Liebl W (2006) Molecular and biochemical
characterization of a-glucosidase and a-mannosidase and their
clustered genes from the thermoacidophilic archaeon Picrophilustorridus. J Bacteriol 188:7123–7131
Boanca G, Sand A, Barycki JJ (2006) Uncoupling the enzymatic and
autoprocessing activities of Helicobacter pylori gamma-gluta-
myltranspeptidase. J Biol Chem 281:9029–19037
Boanca G, Sand A, Okada T, Suzuki H, Kumagai H, Fukuyama K,
Barycki JJ (2007) Autoprocessing of Helicobacter pylori
gamma-glutamyltranspeptidase leads to the formation of a
threonine–threonine catalytic dyad. J Biol Chem 282:534–541
Bradford MM (1976) A rapid and sensitive method for the
quantization of microgram quantities of protein utilizing the
principle of protein-dye binding. Anal Biochem 72:248–254
Burg BVD (2003) Extremophiles as a source for novel enzymes. Curr
Opin Microbiol 6:213–218
Canutescu AA, Shelenkov AA, Dunbrack RL (2003) A graph theory
algorithm for protein side-chain prediction. Protein Sci 12:
2001–2014
Castellano I, Merlino A (2012) c-glutamyltranspeptidases: sequence,
structure, biochemical properties,and biotechnological applica-
tions. Cell Mol Life Sci. doi:10.1007/s00018-012-0988-3
Castellano I, Merlino A, Rossi M, La Cara F (2010) Biochemical and
structural properties of gamma-glutamyl transpeptidase from
Geobacillus thermodenitrificans: an enzyme specialized in
hydrolase activity. Biochimie 92:464–474
Castellano I, Salle AD, Merlino A, Rossi M, La Cara F (2011) Gene
cloning and protein expression of c-glutamyltranspeptidases
from Thermus thermophilus and Deinococcus radiodurans:
comparison of molecular and structural properties with meso-
philic counterparts. Extremophiles 15:259–270
Cavicchioli R (2007) Archaea: molecular and cellular biology. ASM
Press, Washington DC
De Vendittis E, Castellano I, Cotugno R, Ruocco MR, Raimo G,
Masullo M (2008) Adaptation of model proteins from cold to hot
environments involves continuous and small adjustments of
average parameters related to amino acid composition. J Theor
Biol 250:156–171
Duhovny DS, Inbar Y, Nussinov R, Wolfson HJ (2005) PatchDock
and SymmDock: servers for rigid and symmetric docking.
Nucleic Acids Res 33:363–367
Dundas J, Ouyang Z, Tseng J, Binkowski A, Turpaz Y, Liang J (2006)
CASTp: computed atlas of surface topography of proteins with
structural and topographical mapping of functionally annotated
residues. Nucleic Acids Res 34:116–118
Eswar N, Webb B, Marti-Renom MA, Madhusudhan MS, Eramian D,
Shen MY, Pieper U, Sali A (2006) Comparative protein structure
modelling with MODELLER. Current protocols in bioinformat-
ics. Wiley 15:561–5630
Futterer O, Angelov A, Liesegang H, Gottschalk G, Schleper C,
Schepers B, Dock C, Antranikian G, Liebl W (2004) Genome
sequence of Picrophilus torridus and its implications for life
around pH 0. Proc Natl Acad Sci USA 101:9091–9096
Gasteiger E, Hoogland C, Gattiker A, Duvaud S, Wilkins RM, Appel
RD, Bairoch A (2005) Protein identification and analysis tools
on the ExPASy Server. The proteomics protocols handbook,
pp 571–607
Giridhar R, Srivastava AK (2000) Productivity enhancement inL-sorbose fermentation using oxygen vector. Enzyme Microb
Technol 27:537–541
Haney PJ, Badger JH, Buldak GL, Reich CI, Woese CR, Olsen GJ
(1999) Thermal adaptation analyzed by comparison of protein
sequences from mesophilic and extremely thermophilic
Methanococcus species. Proc Natl Acad Sci USA 96:3578–3583
Hooft RW, Vriend R, Sander C, Abola EE (1996) Errors in protein
structures. Nature 381:272
Kim SM, Park JT, Kim YW, Lee HS, Nyawira R, Shin HS, Park CS,
Yoo SH, Kim YR, Moon TW, Park KH (2004) Properties of a
novel thermostable glucomylase from the hyperthermophilic,
archaeon Sulfolobus solfataricus in relation to starch processing.
Appl Environ Microbiol 70:3933–3940
Kinlough CL, Poland PA, Bruns JB, Hughey RP (2005) Gamma-
glutamyltranspeptidase: disulfide bridges, propeptide cleavage,
and activation in the endoplasmic reticulum. Methods Enzymol
401:426–449
40 Extremophiles (2013) 17:29–41
123
Larkin MA, Blackshields G, Brown NP, Chenna R, McGettigan PA,
McWilliam H, Valentin F, Wallace IM, Wilm A, Lopez R,
Thompson JD, Gibson TJ, Higgins DG (2007) Clustal W and
Clustal X version 2.0. Bioinformatics 23:2947–2948
Laskowski RA, MacArthur MW, Moss DS, Thornton JM (1993)
PROCHECK: a program to check the stereo-chemical quality of
protein structure. J Appl Crystallogr 26:283–291
Lee DH, Blomhoff R, Jacobs DR (2004) Is serum gamma-
glutamyltransferase a marker of oxidative stress? Free Radic
Res 38:535–539
Lin LL, Chou PR, Hua YW, Hsu WH (2006) Overexpression, one-step
purification, and biochemical characterization of a recombinant
gamma-glutamyltranspeptidase from Bacillus licheniformis.
Appl Microbiol Biotechnol 73:103–112
McGuffin LJ, Bryson K, Jones DT (2000) The PSIPRED protein
structure prediction server. Bioinformatics Appl Note 16:405–406
Morris GM, Goodsell DS, Halliday RS, Huey R, Hart WE, Belew RK,
Olson AJ (1998) Automated docking using a Lamarckian genetic
algorithm and and empirical binding free energy function.
J Comput Chem 19:1639–1662
Murty NAR, Tiwary E, Sharma R, Nair N, Gupta R (2011) Gamma-
glutamyl transpeptidase from Bacillus pumilus KS 12: decou-
pling autoprocessing from catalysis and molecular characteriza-
tion of N-terminal region. Enzyme Microb Technol 50:159–164
Ohlsson BG, Westrom BR, Karlsson BW (1986) Enzymoblotting: a
method for localizing proteinases and their zymogens using
para-nitroanilide substrates after agarose gel electrophoresis and
transfer to nitrocellulose. Anal Biochem 152:239–244
Okada T, Suzuki H, Wada K, Kumagai H, Fukuyama K (2006)
Crystal structures of gamma-glutamyltranspeptidase from Esch-erichia coli, a key enzyme in glutathione metabolism, and its
reaction intermediate. Proc Natl Acad Sci USA 103:6471–6476
Pompella A, Corti A, Paolicchi A, Giommarelli C, Zunino F (2007)
Gamma-glutamyltransferase, redox regulation and cancer drug
resistance. Curr Opin Pharmacol 7:360–366
Reher M, Fuhrer T, Bott M, Schonheit P (2010) The non-phosphor-
ylative Entner-Doudoroff Pathway in the thermoacidophilic
euryarchaeon Picrophilus torridus involves a novel 2-keto-3-
deoxygluconate-specific aldolase. J Bacteriol 192:964–974
Ruepp A, Graml W, Santos-Martinez MLS, Koretke KK, Volker C,
Mewes HW, Frishman D, Stocker S, Lupas AN, Baumeister W
(2000) The genome sequence of the thermo-acidophilic scaven-
ger Thermoplasma acidophilum. Nature 407:508
Ruppert J, Welch W, Jain AN (1997) Automatic identification and
representation of protein binding sites for molecular docking.
Protein Sci 6:524–533
Schepers B, Theimann V, Antranikian G (2006) Characterization of a
novel glucoamylase from the thermoacidophilic archaeon
Picrophilus torridus heterologously expressed in E. coli. Eng
Life Sci 6:311–317
Seeliger D, De Groot BL (2010) Ligand docking and binding site
analysis with PyMOL and Autodock/Vina. J Comput Aided Mol
Des 24:417–422
Shuai Y, Zhang T, Mu W, Jiang B (2011) Purification and
characterization of gamma-glutamyltranspeptidase from Bacillussubtilis SK11.004. J Agric Food Chem 59:6233–6238
Suzuki H, Kumagai H (2002) Autocatalytic processing of gamma-
glutamyltranspeptidase. J Biol Chem 277:43536–43543
Suzuki H, Kumagai H, Tochikura T (1986) Gamma-glutamyltran-
speptidase from Escherichia coli K-12: purification and proper-
ties. J Bacteriol 168:1325–1331
Suzuki H, Yamada C, Kato K (2007) Gamma-glutamyl compounds
and their enzymatic production using bacterial gamma-gluta-
myltranspeptidase. Amino Acids 32:333–340
Szilagyi A, Zavodsky P (2000) Structural differences between
mesophilic, moderately thermophilic and extremely thermophilic
protein subunits: results of a comprehensive survey. Struct Fold
Des 8:493–504
Takagi M, Tamaki H, Miyamoto Y, Leonardi R, Hanada S, Jackowski
S, Chohnan S (2010) Pantothenate kinase from the thermoacid-
ophilic archaeon Picrophilus torridus. J Bacteriol 192:233–241
Takami H, Nakasone K, Takaki Y, Maeno G, Sasaki R, Masui N, Fuji
F, Hirama C, Nakamura Y, Ogasawara N, Kuhara S, Horikoshi K
(2000) Complete genome sequence of the alkaliphilic bacterium
Bacillus halodurans and genomic sequence comparison with
Bacillus subtilis. Nucleic Acids Res 28:4317–4331
Tate SS, Meister A (1981) Gamma-glutamyl transpeptidase: catalytic,
structural and functional aspects. Mol Cell Biochem 39:357–368
Tate SS, Meister A (1985) Gamma-Glutamyl transpeptidase from
kidney. Methods Enzymol 113:400–419
van der Spoel D, van Druner R, Berendsen HJC (1994) GROningen
MAchine for Chemical Simulation. Department of Biophysical
Chemistry, BIOSON Research Institute, Groningen
Wang Q, Yao Z, Xun Z, Xu X, Xu H, Wei P (2008) Properties and
catalytic mechanism of c-glutamyltranspeptidase from Bacillussubtilis NX-2. Frontiers of Chem Engineer in China 2:456–461
Willard L, Ranjan A, Zhang H, Monzavi H, Boyko RF, Sykes BD,
Wishart DS (2003) VADAR: a web server for quantitative
evaluation of protein structure quality. Nucleic Acids Res
31:3316–3319
Extremophiles (2013) 17:29–41 41
123
Top Related